Pharmaqo US – IGF-DES 1-3
$56.00
Description
Buy Pharmaqo US IGF-DES 1-3 UK | Truncated IGF-1 Analog for Research
Pharmaqo US – IGF-DES 1-3 – Available Now in the UK
For researchers and scientists investigating muscle physiology, cellular hypertrophy, and tissue regeneration, Pharmaqo US – IGF-DES 1-3 delivers a premium research-grade truncated analog of Insulin-like Growth Factor-1. IGF-1 DES (Des(1-3)IGF-1) is a naturally occurring variant of human IGF-1, first isolated from bovine colostrum, human brain, and porcine uterus, characterized by the absence of the N-terminal tripeptide Gly-Pro-Glu . This truncation, specifically the lack of the glutamate residue at position 3, results in dramatically reduced binding to IGF-binding proteins (IGFBPs) while retaining full affinity for the IGF-1 receptor, making it approximately 10-fold more potent than regular IGF-1 in stimulating cellular proliferation and hypertrophy in vitro . Now available from uksteroidshop.co.uk, your trusted UK-based supplier, you can access this premium research compound with the assurance of Pharmaqo US quality.
Whether you’re conducting muscle biology research in Birmingham, studying growth factor signaling in Manchester, or investigating tissue repair mechanisms in Glasgow or Edinburgh, we deliver nationwide. Research facilities across London, Leeds, Liverpool, Bristol, Nottingham, Sheffield, Cardiff, and Belfast trust us for their advanced peptide needs. Experience the quality and consistency required for serious scientific investigation.
Why Choose uksteroidshop.co.uk for Pharmaqo US IGF-DES 1-3
Premium Research-Grade Quality
Pharmaqo US is renowned for producing high-quality research-grade peptides. Every batch of Pharmaqo US – IGF-DES 1-3 meets stringent quality benchmarks, with purity exceeding 97% by SDS-PAGE and HPLC analysis . Endotoxin levels are maintained at less than 50 EU/mg as determined by LAL method, ensuring suitability for sensitive research applications . When you purchase Pharmaqo US IGF-DES from us, you’re investing in premium quality for your laboratory work.
Superior Biological Potency
IGF-1 DES exhibits approximately 10-fold greater potency than full-length IGF-1 in stimulating cell proliferation and hypertrophy . This enhanced activity results from the absence of the glutamate residue at position 3, which drastically reduces binding to IGF-binding proteins while maintaining full receptor affinity . The ED50 as determined by cell proliferation assays using serum-free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of >5.0 × 10⁵ IU/mg .
Distinctive Pharmacokinetic Profile
The N-terminal truncation of IGF-1 DES leads to unique pharmacokinetic properties that distinguish it from the full-length molecule:
-
Shorter Half-Life: The half-life of des(1-3)IGF-I in rats is approximately 20.5 minutes, compared to 228.3 minutes for intact IGF-I
-
Rapid Clearance: The truncated variant is cleared much more rapidly from circulation, with greater urinary excretion
-
Tissue Distribution: Preferential uptake is observed in skeletal muscle, kidney, and testis
Authenticity Guaranteed
The market is flooded with counterfeit products, but uksteroidshop.co.uk guarantees you receive Genuine Pharmaqo US – IGF-DES 1-3. We source directly from authorised Pharmaqo US distributors to ensure you are getting the real deal, not a dangerous substitute. Every vial is verified authentic.
UK Stock Availability
Forget waiting weeks for international parcels. We maintain deep UK stock ready to ship, meaning your order is processed and dispatched promptly from within the country. When you order Pharmaqo US IGF-DES online, it ships from the UK immediately.
Secure Checkout Process
Your privacy and security are our priority. Our secure & private checkout system protects your data, allowing you to complete your transaction with complete peace of mind.
Trusted by Researchers
Join the ranks of research professionals across the UK who rely on us for their laboratory peptide needs. We have built our reputation on reliability, product quality, and exceptional service. We are Trusted by UK research facilities nationwide, particularly those conducting growth factor and muscle physiology studies.
Key Product Specifications
-
Molecular Mass: Approximately 7.4 kDa, a single non-glycosylated polypeptide chain containing 67 amino acids
-
Amino Acid Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
-
Protein Length: 67 amino acids (full-length IGF-1 is 70 amino acids)
-
Source: Recombinantly expressed in Escherichia coli
-
Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4
-
Purity: >97% by SDS-PAGE and HPLC analysis
-
Biological Activity: ED50 <2 ng/ml in MCF-7 cell proliferation assay
-
Endotoxin: <50 EU/mg
Key Research Findings on IGF-1 DES
Structural Characteristics
IGF-1 DES is a truncated variant of human IGF-1 lacking the N-terminal tripeptide Gly-Pro-Glu . This post-translational cleavage product has been isolated from multiple biological sources including bovine colostrum, human brain, and porcine uterus . The absence of the glutamate residue at position 3 is responsible for its dramatically reduced binding to IGF-binding proteins .
Enhanced Receptor Activation
Systematic studies have shown that removal of Glu3 accounts for the dramatic loss of binding affinity for IGF-BPs, while the variant retains affinity of intact IGF-I for the signaling IGF-type I receptor . Des-(1–3)-IGF-I has an average of only ∼1% of the affinity of native IGF-I for the IGF-BPs . This reduced binding to carrier proteins increases the concentration of free, bioavailable hormone available to interact with cellular receptors.
Cellular Effects
IGF-1 DES binds the IGF-1 receptor (a cell-surface tyrosine-kinase receptor) more readily than full-length IGF-1, triggering intracellular signaling that promotes cell growth and survival . It accelerates receptor-mediated activation of the PI3K/Akt pathway, a signaling cascade involved in protein synthesis . In plain terms, it more effectively “turns on” growth and repair signals in target cells.
Blood-Brain Barrier Interactions
Research demonstrates that des(1-3)IGF-1 has a shorter half-life in blood, slower influx rate into brain, and no alteration in pharmacokinetics after addition of nonradiolabeled peptide, in contrast to full-length IGF-1 which exhibits saturable transport . This suggests distinct CNS delivery mechanisms for the truncated variant.
Tissue Distribution Patterns
Following intravenous administration in rats, maximal accumulation of all IGF peptides was found in the kidney . Skeletal muscle, kidney, and testis showed preferential uptake of the truncated variants . The distribution pattern for IGF-I and -II was: kidney > pancreas > small intestine > liver > duodenum > stomach > lung > spleen > heart > large intestine > testis > brain > skeletal muscle .
How to Use Pharmaqo US IGF-DES 1-3 for Research Applications
For research professionals utilizing Pharmaqo US – IGF-DES 1-3 in laboratory settings, understanding proper protocols is essential for experimental validity.
-
Form & Potency: This product is supplied as a lyophilized (freeze-dried) powder in a sterile vial containing Pharmaqo US IGF-DES 1-3. (Specific vial potency would typically be listed on product packaging.)
-
Reconstitution: IGF-1 DES must be reconstituted with sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL .
-
Briefly centrifuge the vial prior to opening to bring contents to the bottom
-
Gently swirl (do not vortex) to dissolve; avoid vigorous shaking
-
Stock solutions should be apportioned into working aliquots and stored at ≤-20°C
-
Further dilutions should be made in appropriate buffered solutions
-
-
Half-Life Considerations: Research studies demonstrate that des(1-3)IGF-I has a half-life of approximately 20.5 minutes in rats, substantially shorter than the 228.3 minutes of intact IGF-I . This rapid clearance should be considered when designing experimental protocols.
-
Administration Routes for Research:
-
Intravenous (IV): Used in pharmacokinetic studies to determine half-life and tissue distribution
-
Subcutaneous (SC): Human studies have used 20–50 µg/kg administered subcutaneously once or twice daily for up to two weeks
-
Intramuscular (IM): For localized tissue studies, direct intramuscular injection may be appropriate
-
-
Storage:
-
Lyophilized powder: 12 months from date of receipt, -20 to -70°C as supplied
-
After reconstitution: 1 month at 2-8°C under sterile conditions; 3 months at -20 to -70°C under sterile conditions
-
Avoid repeated freeze-thaw cycles; aliquot into working volumes
-
-
In Vitro Applications: Cell culture studies have utilized concentrations established through dose-response curves. The ED50 for MCF-7 cell proliferation is less than 2 ng/ml .
-
In Vivo Applications: Animal studies have demonstrated enhanced potency of des(1-3)IGF-I relative to IGF-I in growth hormone-deficient animals, with selective anabolic effects particularly evident in gut tissues .
-
Important Research Considerations:
-
For research use only; not for human consumption
-
Not approved for therapeutic use by FDA, EMA, or other regulatory authorities
-
Must be used under approved research protocols with appropriate oversight
-
Monitor blood glucose in relevant animal models due to insulin-like activity
-
Note: This product is intended for research use only and is not for human consumption. Not for diagnostic or therapeutic use in humans.
Discreet & Fast UK Delivery on Pharmaqo US IGF-DES 1-3
When you buy Pharmaqo US IGF-DES 1-3 UK from us, you expect a service that matches the quality of the product. We guarantee fast UK delivery (1–3 working days) to your door. Every order is shipped using discreet packaging, with no branding or labels that hint at the contents. Our discreet supplement delivery UK service ensures your privacy from our warehouse to your home or research facility, whether you’re in a bustling city centre like Bristol or a quiet town outside Sheffield. We are the choice for fast delivery supplements UK researchers trust for their laboratory peptide needs.
Who Pharmaqo US IGF-DES 1-3 Is For
This research-grade peptide is designed for scientific researchers, laboratory professionals, and research institutions conducting studies in muscle physiology, growth factor signaling, cell proliferation, and tissue regeneration. It is particularly valuable for those investigating the enhanced potency of truncated IGF analogs, the role of IGF-binding proteins in modulating growth factor activity, and localized effects of IGF-1 receptor activation. If you are a research professional dedicated to advancing scientific understanding through rigorous investigation, and you require high-quality research peptides for your work, Pharmaqo US IGF-DES 1-3 is your essential research tool. Check our competitive Pharmaqo US IGF-DES 1-3 price UK research professionals appreciate.
Order Pharmaqo US IGF-DES 1-3 Online from uksteroidshop.co.uk
Ready to advance your research with a premium, high-potency IGF-1 analog? Securing your supply of Pharmaqo US IGF-DES 1-3 for sale UK is simple. We offer a competitive price UK researchers will appreciate, combined with a seamless ordering experience.
Support your scientific investigations with quality research peptides. Click below to add to your cart and experience the fast delivery supplements UK research professionals trust.
[ORDER NOW – ADD TO CART]
Join the research facilities across the UK who have made uksteroidshop.co.uk their trusted source for premium research peptides. Advance your growth factor and muscle physiology research with Pharmaqo US IGF-DES 1-3. Pharmaqo US IGF-DES for sale – order now for rapid dispatch.
Frequently Asked Questions for Researchers
What is IGF-1 DES and how does it differ from regular IGF-1?
IGF-1 DES (Des(1-3)IGF-1) is a naturally occurring truncated variant of human insulin-like growth factor-1, missing the first three N-terminal amino acids (Gly-Pro-Glu) . This truncation, specifically the absence of the glutamate residue at position 3, results in dramatically reduced binding to IGF-binding proteins (IGFBPs)—approximately 1% of the affinity of native IGF-I—while retaining full affinity for the IGF-1 receptor . Consequently, it exhibits about 10-fold greater potency than regular IGF-1 in stimulating cell proliferation and hypertrophy .
What is the half-life of IGF-1 DES in research models?
Research studies in rats demonstrate that des(1-3)IGF-I has a half-life of approximately 20.5 minutes, substantially shorter than the 228.3 minutes of intact IGF-I . The truncated variant is cleared much more rapidly from circulation, with greater urinary excretion, and shows preferential uptake in skeletal muscle, kidney, and testis .
How do I reconstitute Pharmaqo US IGF-DES 1-3?
IGF-1 DES is supplied as a lyophilized powder that requires reconstitution. Briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL . Gently swirl to dissolve; avoid vigorous shaking. Stock solutions should be apportioned into working aliquots and stored at ≤-20°C. Further dilutions should be made in appropriate buffered solutions.
What is the biological activity specification?
Pharmaqo US IGF-DES 1-3 is fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum-free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of >5.0 × 10⁵ IU/mg .
How should IGF-1 DES be stored?
Lyophilized powder is stable for 12 months from date of receipt when stored at -20 to -70°C as supplied . After reconstitution, the peptide is stable for 1 month at 2-8°C under sterile conditions, or 3 months at -20 to -70°C under sterile conditions . Avoid repeated freeze-thaw cycles; aliquot into working volumes.
Is the Pharmaqo US IGF-DES 1-3 you sell authentic?
Absolutely. We are a UK-based supplier with a reputation to protect in the research community. We guarantee that every vial of Pharmaqo US IGF-DES 1-3 sold on uksteroidshop.co.uk is 100% genuine, sourced directly from authorised Pharmaqo US distributors and stored correctly under controlled temperatures to maintain its premium quality assurance. When you purchase Pharmaqo US IGF-DES from us for your research, authenticity is guaranteed.
What is the typical purity of Pharmaqo US IGF-DES 1-3?
Each batch exceeds >97% purity as determined by SDS-PAGE and HPLC analyses . Endotoxin levels are maintained at less than 50 EU/mg as determined by LAL method, ensuring suitability for sensitive research applications .
What is the typical Pharmaqo US IGF-DES 1-3 price UK for research purposes?
We pride ourselves on offering competitive pricing for all our premium research peptides. The Pharmaqo US IGF-DES 1-3 price UK listed on our site reflects the superior research-grade quality of this high-potency IGF-1 analog while ensuring excellent value for research facilities and scientific professionals. Check the product page for current pricing and multi-buy offers for laboratories





Stefan Anderson –
I noticed consistent performance based on my personal experience, and the packaging was secure.
Daniel Brown –
No issues from start to finish after a few days of use, and communication was clear.
Tiago Muller –
I had a positive experience compared to similar products, and I would consider ordering again.
Thomas Meyer –
I had a positive experience over the course of several weeks, and delivery was timely.
Luis Kral –
This worked well for my needs with consistent results, and overall I am pleased.
Mario Pedersen –
I am satisfied with the overall quality once I added it into my plan, and everything felt properly handled.
Mario Kaczmarek –
This worked well for my needs from the first use, and delivery was timely.